EMP2 (NM_001424) Human Mass Spec Standard
CAT#: PH301995
EMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001415)
View other "EMP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001415) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201995 |
| Predicted MW | 19.2 kDa |
| Protein Sequence |
>RC201995 protein sequence
Red=Cloning site Green=Tags(s) MLVLLAFIIAFHITSAALLFIATVDNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYSTLQAVQATMIL STILCCIAFFIFVLQLFRLKQGERFVLTSIIQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYG YSYILAWVAFACTFISGMMYLILRKRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001415 |
| RefSeq Size | 5186 |
| RefSeq ORF | 501 |
| Synonyms | XMP |
| Locus ID | 2013 |
| Cytogenetics | 16p13.13 |
| Summary | This gene encodes a tetraspan protein of the PMP22/EMP family. The encoded protein regulates cell membrane composition. It has been associated with various functions including endocytosis, cell signaling, cell proliferation, cell migration, cell adhesion, cell death, cholesterol homeostasis, urinary albumin excretion, and embryo implantation. It is known to negatively regulate caveolin-1, a scaffolding protein which is the main component of the caveolae plasma membrane invaginations found in most cell types. Through activation of PTK2 it positively regulates vascular endothelial growth factor A. It also modulates the function of specific integrin isomers in the plasma membrane. Up-regulation of this gene has been linked to cancer progression in multiple different tissues. Mutations in this gene have been associated with nephrotic syndrome type 10 (NPHS10). [provided by RefSeq, Mar 2015] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400553 | EMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400553 | Transient overexpression lysate of epithelial membrane protein 2 (EMP2) |
CNY 3080.00 |
|
| TP301995 | Recombinant protein of human epithelial membrane protein 2 (EMP2), 20 µg |
CNY 2900.00 |
