ETS1 associated protein II (TDP2) (NM_016614) Human Mass Spec Standard
CAT#: PH302015
TTRAP MS Standard C13 and N15-labeled recombinant protein (NP_057698)
View other "ETS1 associated protein II" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TTRAP MS Standard C13 and N15-labeled recombinant protein (NP_057698) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202015 |
| Predicted MW | 40.9 kDa |
| Protein Sequence |
>RC202015 protein sequence
Red=Cloning site Green=Tags(s) MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESA LERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYL ALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTKMMRNLLC VHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNI VDVWEFLGKPKHCQYTWDTQMNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD HWGLLCNLDIIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057698 |
| RefSeq Size | 1940 |
| RefSeq ORF | 1086 |
| Synonyms | AD022; dJ30M3.3; EAP2; EAPII; hTDP2; TTRAP |
| Locus ID | 51567 |
| Cytogenetics | 6p22.3 |
| Summary | This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413867 | TDP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413867 | Transient overexpression lysate of TRAF and TNF receptor associated protein (TTRAP) |
CNY 3080.00 |
|
| TP302015 | Recombinant protein of human TRAF and TNF receptor associated protein (TTRAP), 20 µg |
CNY 2900.00 |
其它ETS1 associated protein II产品
