Glycogenin 2 (GYG2) (NM_001079855) Human Mass Spec Standard
CAT#: PH302043
GYG2 MS Standard C13 and N15-labeled recombinant protein (NP_001073324)
View other "Glycogenin 2" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GYG2 MS Standard C13 and N15-labeled recombinant protein (NP_001073324) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202043 |
| Predicted MW | 52 kDa |
| Protein Sequence |
>RC202043 protein sequence
Red=Cloning site Green=Tags(s) MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSAD YIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFV FQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSA KVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTL CRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIAC PETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDL AVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001073324 |
| RefSeq Size | 3318 |
| RefSeq ORF | 1410 |
| Synonyms | GN-2; GN2 |
| Locus ID | 8908 |
| Cytogenetics | Xp22.33 |
| Summary | This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glycogenin mainly present in liver; both are involved in blood glucose homeostasis. This gene has a short version on chromosome Y, which is 3' truncated and can not make a functional protein. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, May 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421559 | GYG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433068 | GYG2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421559 | Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 1 |
CNY 3080.00 |
|
| LY433068 | Transient overexpression lysate of glycogenin 2 (GYG2), transcript variant 4 |
CNY 3080.00 |
|
| TP302043 | Recombinant protein of human glycogenin 2 (GYG2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP330068 | Recombinant protein of human glycogenin 2 (GYG2), transcript variant 4, 20 µg |
CNY 2900.00 |
其它Glycogenin 2产品
