MLC1SA (MYL6B) (NM_002475) Human Mass Spec Standard
CAT#: PH302076
MYL6B MS Standard C13 and N15-labeled recombinant protein (NP_002466)
View other "MLC1SA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | MYL6B MS Standard C13 and N15-labeled recombinant protein (NP_002466) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202076 |
| Predicted MW | 22.8 kDa |
| Protein Sequence |
>RC202076 protein sequence
Red=Cloning site Green=Tags(s) MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFK EAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQ GTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002466 |
| RefSeq Size | 1008 |
| RefSeq ORF | 624 |
| Synonyms | MLC1SA |
| Locus ID | 140465 |
| Cytogenetics | 12q13.2 |
| Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010] |
| Protein Pathways | Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419310 | MYL6B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419310 | Transient overexpression lysate of myosin, light chain 6B, alkali, smooth muscle and non-muscle (MYL6B) |
CNY 3080.00 |
|
| TP302076 | Recombinant protein of human myosin, light chain 6B, alkali, smooth muscle and non-muscle (MYL6B), 20 µg |
CNY 2900.00 |
