alpha 1 Antitrypsin (SERPINA1) (NM_000295) Human Mass Spec Standard
CAT#: PH302082
SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_000286)
View other "alpha 1 Antitrypsin" proteins (41)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
Product Data | |
Description | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_000286) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202082 |
Predicted MW | 46.7 kDa |
Protein Sequence |
>RC202082 protein sequence
Red=Cloning site Green=Tags(s) MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSN STNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGN GLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVN YIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPD EGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIDQNTKSPLFMGKVVNPTQK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000286 |
RefSeq Size | 3220 |
RefSeq ORF | 1254 |
Synonyms | A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO2275 |
Locus ID | 5265 |
Cytogenetics | 14q32.13 |
Summary | The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400112 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424179 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426858 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426859 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426860 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426861 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426862 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426863 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426864 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426865 | SERPINA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400112 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1 |
CNY 3080.00 |
|
LY424179 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2 |
CNY 4840.00 |
|
LY426858 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4 |
CNY 3080.00 |
|
LY426859 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5 |
CNY 3080.00 |
|
LY426860 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6 |
CNY 3080.00 |
|
LY426861 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7 |
CNY 3080.00 |
|
LY426862 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8 |
CNY 3080.00 |
|
LY426863 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9 |
CNY 3080.00 |
|
LY426864 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10 |
CNY 3080.00 |
|
LY426865 | Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11 |
CNY 3080.00 |
|
PH321489 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001002236) |
CNY 19520.00 |
|
PH325656 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121173) |
CNY 14250.00 |
|
PH325657 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121174) |
CNY 14250.00 |
|
PH325658 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121175) |
CNY 14250.00 |
|
PH325659 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121176) |
CNY 14250.00 |
|
PH325661 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121177) |
CNY 14250.00 |
|
PH325663 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121178) |
CNY 14250.00 |
|
PH325664 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121179) |
CNY 14250.00 |
|
PH325668 | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121172) |
CNY 14250.00 |
|
TP302082 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP321489 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP325656 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 5, 20 µg |
CNY 2900.00 |
|
TP325657 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 6, 20 µg |
CNY 2900.00 |
|
TP325658 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 7, 20 µg |
CNY 2900.00 |
|
TP325659 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 8, 20 µg |
CNY 2900.00 |
|
TP325661 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 9, 20 µg |
CNY 2900.00 |
|
TP325663 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 10, 20 µg |
CNY 2900.00 |
|
TP325664 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 11, 20 µg |
CNY 2900.00 |
|
TP325668 | Purified recombinant protein of Homo sapiens serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP701025 | Purified protein of human z-type alpha-1-antitrypsin protein Glu342Lys mutant, Tag Free, secretory expressed in HEK cells, 50ug |
CNY 6650.00 |
|
TP760123 | Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 (SERPINA1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它alpha 1 Antitrypsin产品