TRIM21 (NM_003141) Human Mass Spec Standard
CAT#: PH302088
TRIM21 MS Standard C13 and N15-labeled recombinant protein (NP_003132)
View other "TRIM21" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | TRIM21 MS Standard C13 and N15-labeled recombinant protein (NP_003132) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202088 |
Predicted MW | 54.2 kDa |
Protein Sequence |
>RC202088 protein sequence
Red=Cloning site Green=Tags(s) MASAARLTMMWEEVTCPICLDPFVEPVSIECGHSFCQECISQVGKGGGSVCPVCRQRFLLKNLRPNRQLA NMVNNLKEISQEAREGTQGERCAVHGERLHLFCEKDGKALCWVCAQSRKHRDHAMVPLEEAAQEYQEKLQ VALGELRRKQELAEKLEVEIAIKRADWKKTVETQKSRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRI LGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKK MLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTG KEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSF YNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003132 |
RefSeq Size | 1946 |
RefSeq ORF | 1425 |
Synonyms | RNF81; Ro/SSA; RO52; SSA; SSA1 |
Locus ID | 6737 |
Cytogenetics | 11p15.4 |
Summary | This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The encoded protein is part of the RoSSA ribonucleoprotein, which includes a single polypeptide and one of four small RNA molecules. The RoSSA particle localizes to both the cytoplasm and the nucleus. RoSSA interacts with autoantigens in patients with Sjogren syndrome and systemic lupus erythematosus. Alternatively spliced transcript variants for this gene have been described but the full-length nature of only one has been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Systemic lupus erythematosus |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
TRIM21, a negative modulator of LFG in breast carcinoma MDA-MB-231 cells in vitro
,null,
International Journal of Oncology
,PubMed ID 26398169
[TRIM21]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401090 | TRIM21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401090 | Transient overexpression lysate of tripartite motif-containing 21 (TRIM21) |
CNY 3080.00 |
|
TP302088 | Recombinant protein of human tripartite motif-containing 21 (TRIM21), 20 µg |
CNY 2900.00 |