FA2H (NM_024306) Human Mass Spec Standard
CAT#: PH302093
FA2H MS Standard C13 and N15-labeled recombinant protein (NP_077282)
View other "FA2H" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FA2H MS Standard C13 and N15-labeled recombinant protein (NP_077282) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202093 |
| Predicted MW | 42.8 kDa |
| Protein Sequence |
>RC202093 protein sequence
Red=Cloning site Green=Tags(s) MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHS ANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEK YDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAV PKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLV IGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGI STKLWDYCFHTLTPEKPHLKTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_077282 |
| RefSeq Size | 2450 |
| RefSeq ORF | 1116 |
| Synonyms | FAAH; FAH1; FAXDC1; SCS7; SPG35 |
| Locus ID | 79152 |
| Cytogenetics | 16q23.1 |
| Summary | This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia.[provided by RefSeq, Mar 2010] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411325 | FA2H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411325 | Transient overexpression lysate of fatty acid 2-hydroxylase (FA2H) |
CNY 3080.00 |
|
| TP302093 | Recombinant protein of human fatty acid 2-hydroxylase (FA2H), 20 µg |
CNY 2900.00 |
