ETHE1 (NM_014297) Human Mass Spec Standard
CAT#: PH302114
ETHE1 MS Standard C13 and N15-labeled recombinant protein (NP_055112)
View other "ETHE1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ETHE1 MS Standard C13 and N15-labeled recombinant protein (NP_055112) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202114 |
| Predicted MW | 27.9 kDa |
| Protein Sequence |
>RC202114 protein sequence
Red=Cloning site Green=Tags(s) MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGL RLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCV TFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERT LNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANMRCGVQTPTA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055112 |
| RefSeq Size | 978 |
| RefSeq ORF | 762 |
| Synonyms | HSCO; YF13H12 |
| Locus ID | 23474 |
| Cytogenetics | 19q13.31 |
| Summary | This gene encodes a member of the metallo beta-lactamase family of iron-containing proteins involved in the mitochondrial sulfide oxidation pathway. The encoded protein catalyzes the oxidation of a persulfide substrate to sulfite. Certain mutations in this gene cause ethylmalonic encephalopathy, an infantile metabolic disorder affecting the brain, gastrointestinal tract and peripheral vessels. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402306 | ETHE1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402306 | Transient overexpression lysate of ethylmalonic encephalopathy 1 (ETHE1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP302114 | Recombinant protein of human ethylmalonic encephalopathy 1 (ETHE1), 20 µg |
CNY 2900.00 |
