MAGE 1 (MAGEA1) (NM_004988) Human Mass Spec Standard
CAT#: PH302134
MAGEA1 MS Standard C13 and N15-labeled recombinant protein (NP_004979)
View other "MAGE 1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 14250.00
Specifications
| Product Data | |
| Description | MAGEA1 MS Standard C13 and N15-labeled recombinant protein (NP_004979) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC202134 | 
| Predicted MW | 34.3 kDa | 
| Protein Sequence | 
                 >RC202134 protein sequence 
Red=Cloning site Green=Tags(s) MSLEQRSLHCKPEEALEAQQEALGLVCVQAAASSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINF TRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCF PEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAP EEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVL EYVIKVSARVRFFFPSLREAALREEEEGV myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_004979 | 
| RefSeq Size | 1755 | 
| RefSeq ORF | 927 | 
| Synonyms | CT1.1; MAGE1 | 
| Locus ID | 4100 | 
| Cytogenetics | Xq28 | 
| Summary | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401552 | MAGEA1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401552 | Transient overexpression lysate of melanoma antigen family A, 1 (directs expression of antigen MZ2-E) (MAGEA1) | 
                                                     CNY 3080.00  | 
                                            |
| TP302134 | Purified recombinant protein of Homo sapiens melanoma antigen family A, 1 (directs expression of antigen MZ2-E) (MAGEA1), 20 µg | 
                                                     CNY 2900.00  | 
                                            
