ACTR3B (NM_020445) Human Mass Spec Standard
CAT#: PH302148
ACTR3B MS Standard C13 and N15-labeled recombinant protein (NP_065178)
View other "ACTR3B" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ACTR3B MS Standard C13 and N15-labeled recombinant protein (NP_065178) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202148 |
| Predicted MW | 47.6 kDa |
| Protein Sequence |
>RC202148 protein sequence
Red=Cloning site Green=Tags(s) MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKP TYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLY IAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE REVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPE IFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_065178 |
| RefSeq Size | 2223 |
| RefSeq ORF | 1254 |
| Synonyms | ARP3BETA; ARP11 |
| Locus ID | 57180 |
| Cytogenetics | 7q36.1-q36.2 |
| Summary | This gene encodes a member of the actin-related proteins (ARP), which form multiprotein complexes and share 35-55% amino acid identity with conventional actin. The protein encoded by this gene may have a regulatory role in the actin cytoskeleton and induce cell-shape change and motility. Pseudogenes of this gene are located on chromosomes 2, 4, 10, 16, 22 and Y. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412453 | ACTR3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421689 | ACTR3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412453 | Transient overexpression lysate of ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 1 |
CNY 3080.00 |
|
| LY421689 | Transient overexpression lysate of ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 2 |
CNY 3080.00 |
|
| TP302148 | Recombinant protein of human ARP3 actin-related protein 3 homolog B (yeast) (ACTR3B), transcript variant 1, 20 µg |
CNY 2900.00 |
