KEAP1 (NM_203500) Human Mass Spec Standard
CAT#: PH302189
KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_987096)
View other "KEAP1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_987096) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202189 |
| Predicted MW | 69.7 kDa |
| Protein Sequence |
>RC202189 protein sequence
Red=Cloning site Green=Tags(s) MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL RLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGMEVVSIEGIHPKVMERLIEFA YTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCVELHQRAREYIYMH FGEVAKQEEFFNLSHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNF LQMQLQKCEILQSDSRCKDYLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDG TWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECY YPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGIT VHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_987096 |
| RefSeq Size | 2606 |
| RefSeq ORF | 1872 |
| Synonyms | INrf2; KLHL19 |
| Locus ID | 9817 |
| Cytogenetics | 19p13.2 |
| Summary | This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402183 | KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404250 | KEAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402183 | Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2 |
CNY 3080.00 |
|
| LY404250 | Transient overexpression lysate of kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1 |
CNY 3080.00 |
|
| PH302513 | KEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036421) |
CNY 19520.00 |
|
| TP302189 | Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP302513 | Recombinant protein of human kelch-like ECH-associated protein 1 (KEAP1), transcript variant 2, 20 µg |
CNY 2900.00 |


