DIMT1L (DIMT1) (NM_014473) Human Mass Spec Standard
CAT#: PH302326
DIMT1L MS Standard C13 and N15-labeled recombinant protein (NP_055288)
View other "DIMT1L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | DIMT1L MS Standard C13 and N15-labeled recombinant protein (NP_055288) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202326 |
| Predicted MW | 35.2 kDa |
| Protein Sequence |
>RC202326 protein sequence
Red=Cloning site Green=Tags(s) MPKVKSGAIGRRRGRQEQRRELKSAGGLMFNTGIGQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNM TVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFK LLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIE PKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADKIQQIL TSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055288 |
| RefSeq Size | 1557 |
| RefSeq ORF | 939 |
| Synonyms | DIM1; DIMT1L; HSA9761; HUSSY5 |
| Locus ID | 27292 |
| Cytogenetics | 5q12.1 |
| Summary | The protein encoded by this gene is a methyltransferase that is responsible for dimethylation of adjacent adenosines near the 18S rRNA decoding site. The encoded protein is essential for ribosome biogenesis, although its catalytic activity is not involved in the process. The yeast ortholog of this protein functions in the cytoplasm while this protein functions in the nucleus. [provided by RefSeq, Jan 2017] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415255 | DIMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415255 | Transient overexpression lysate of DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) (DIMT1L) |
CNY 3080.00 |
|
| TP302326 | Recombinant protein of human DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) (DIMT1L), 20 µg |
CNY 2900.00 |
