LSM14A (NM_015578) Human Mass Spec Standard
CAT#: PH302352
LSM14A MS Standard C13 and N15-labeled recombinant protein (NP_056393)
View other "LSM14A" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LSM14A MS Standard C13 and N15-labeled recombinant protein (NP_056393) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202352 |
Predicted MW | 50.6 kDa |
Protein Sequence |
>RC202352 protein sequence
Red=Cloning site Green=Tags(s) MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGS DIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSTSSFQSMGSYGPFGRMPTYSQFSPSSLVGQQFGAVGVAG SSLTSFGTETSNSGTLPQSSAVGSAFTQDTRSLKTQLSQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPA AVGRRSPVSTRPLPSASQKAGENQEHRRAEVHKVSRPENEQLRNDNKRQVAPGAPSAPRRGRGGHRGGRG RFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGN ADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGG RGRGGGRGGTFTAPRGFRGGFRGGRGGREFADFEYRKDNKVAA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056393 |
RefSeq Size | 3715 |
RefSeq ORF | 1389 |
Synonyms | C19orf13; FAM61A; RAP55; RAP55A |
Locus ID | 26065 |
Cytogenetics | 19q13.11 |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414433 | LSM14A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426447 | LSM14A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414433 | Transient overexpression lysate of LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2 |
CNY 3080.00 |
|
LY426447 | Transient overexpression lysate of LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 1 |
CNY 3080.00 |
|
PH325784 | LSM14A MS Standard C13 and N15-labeled recombinant protein (NP_001107565) |
CNY 19520.00 |
|
TP302352 | Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP325784 | Recombinant protein of human LSM14A, SCD6 homolog A (S. cerevisiae) (LSM14A), transcript variant 1, 20 µg |
CNY 2900.00 |