GLTP (NM_016433) Human Mass Spec Standard
CAT#: PH302383
GLTP MS Standard C13 and N15-labeled recombinant protein (NP_057517)
View other "GLTP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GLTP MS Standard C13 and N15-labeled recombinant protein (NP_057517) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202383 |
| Predicted MW | 23.8 kDa |
| Protein Sequence |
>RC202383 protein sequence
Red=Cloning site Green=Tags(s) MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTL QNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYH GWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057517 |
| RefSeq Size | 2371 |
| RefSeq ORF | 627 |
| Locus ID | 51228 |
| Cytogenetics | 12q24.11 |
| Summary | The protein encoded by this gene is similar to bovine and porcine proteins which accelerate transfer of certain glycosphingolipids and glyceroglycolipids between membranes. It is thought to be a cytoplasmic protein. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414018 | GLTP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414018 | Transient overexpression lysate of glycolipid transfer protein (GLTP) |
CNY 3080.00 |
|
| TP302383 | Recombinant protein of human glycolipid transfer protein (GLTP), 20 µg |
CNY 2900.00 |
