DUSP12 (NM_007240) Human Mass Spec Standard
CAT#: PH302411
DUSP12 MS Standard C13 and N15-labeled recombinant protein (NP_009171)
View other "DUSP12" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DUSP12 MS Standard C13 and N15-labeled recombinant protein (NP_009171) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202411 |
Predicted MW | 37.7 kDa |
Protein Sequence |
>RC202411 protein sequence
Red=Cloning site Green=Tags(s) MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGP GVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEK AYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVS QGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESAL LGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009171 |
RefSeq Size | 1271 |
RefSeq ORF | 1020 |
Synonyms | DUSP1; YVH1 |
Locus ID | 11266 |
Cytogenetics | 1q23.3 |
Summary | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is the human ortholog of the Saccharomyces cerevisiae YVH1 protein tyrosine phosphatase. It is localized predominantly in the nucleus, and is novel in that it contains, and is regulated by a zinc finger domain. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416108 | DUSP12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416108 | Transient overexpression lysate of dual specificity phosphatase 12 (DUSP12) |
CNY 3080.00 |
|
TP302411 | Recombinant protein of human dual specificity phosphatase 12 (DUSP12), 20 µg |
CNY 2900.00 |