RGS16 (NM_002928) Human Mass Spec Standard
CAT#: PH302430
RGS16 MS Standard C13 and N15-labeled recombinant protein (NP_002919)
View other "RGS16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RGS16 MS Standard C13 and N15-labeled recombinant protein (NP_002919) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202430 |
| Predicted MW | 22.8 kDa |
| Protein Sequence |
>RC202430 protein sequence
Red=Cloning site Green=Tags(s) MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSEDVLGWRESFDLLL SSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKEVNIDHETRELT RMNLQTATATCFDAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002919 |
| RefSeq Size | 2432 |
| RefSeq ORF | 606 |
| Synonyms | A28-RGS14; A28-RGS14P; RGS-R |
| Locus ID | 6004 |
| Cytogenetics | 1q25.3 |
| Summary | The protein encoded by this gene belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419009 | RGS16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419009 | Transient overexpression lysate of regulator of G-protein signaling 16 (RGS16) |
CNY 3080.00 |
|
| TP302430 | Recombinant protein of human regulator of G-protein signaling 16 (RGS16), 20 µg |
CNY 2900.00 |
