Phosphoserine Aminotransferase (PSAT1) (NM_058179) Human Mass Spec Standard
CAT#: PH302475
PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059)
View other "Phosphoserine Aminotransferase" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSAT1 MS Standard C13 and N15-labeled recombinant protein (NP_478059) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202475 |
| Predicted MW | 40.2 kDa |
| Protein Sequence |
>RC202475 representing NM_058179
Red=Cloning site Green=Tags(s) MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT IEDVQKLAAFMKKFLEMHQL SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_478059 |
| RefSeq Size | 2221 |
| RefSeq ORF | 1110 |
| Synonyms | EPIP; NLS2; PSA; PSAT; PSATD |
| Locus ID | 29968 |
| Cytogenetics | 9q21.2 |
| Summary | This gene encodes a member of the class-V pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is a phosphoserine aminotransferase and decreased expression may be associated with schizophrenia. Mutations in this gene are also associated with phosphoserine aminotransferase deficiency. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, and 8. [provided by RefSeq, Jul 2013] |
| Protein Pathways | Glycine, serine and threonine metabolism, Metabolic pathways, Vitamin B6 metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409248 | PSAT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409248 | Transient overexpression lysate of phosphoserine aminotransferase 1 (PSAT1), transcript variant 1 |
CNY 3080.00 |
|
| TP302475 | Recombinant protein of human phosphoserine aminotransferase 1 (PSAT1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Phosphoserine Aminotransferase产品

