PAG608 (ZMAT3) (NM_022470) Human Mass Spec Standard
CAT#: PH302508
ZMAT3 MS Standard C13 and N15-labeled recombinant protein (NP_071915)
View other "PAG608" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ZMAT3 MS Standard C13 and N15-labeled recombinant protein (NP_071915) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202508 |
Predicted MW | 32.1 kDa |
Protein Sequence |
>RC202508 protein sequence
Red=Cloning site Green=Tags(s) MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKPL YCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPAATPVVPVPPQMGSFKPGGRV ILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEAQSNSFSESSELGQRRARKEGNEFKMMPNRR NMYTVQNNSAGPYFNPRSRQRIPRDLAMCVTPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYR NEMENLGYV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071915 |
RefSeq Size | 8995 |
RefSeq ORF | 867 |
Synonyms | PAG608; WIG-1; WIG1 |
Locus ID | 64393 |
Cytogenetics | 3q26.32 |
Summary | This gene encodes a protein containing three zinc finger domains and a nuclear localization signal. The mRNA and the protein of this gene are upregulated by wildtype p53 and overexpression of this gene inhibits tumor cell growth, suggesting that this gene may have a role in the p53-dependent growth regulatory pathway. Alternative splicing of this gene results in two transcript variants encoding two isoforms differing in only one amino acid. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403457 | ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411657 | ZMAT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403457 | Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 2 |
CNY 3080.00 |
|
LY411657 | Transient overexpression lysate of zinc finger, matrin type 3 (ZMAT3), transcript variant 1 |
CNY 3080.00 |
|
TP302508 | Recombinant protein of human zinc finger, matrin type 3 (ZMAT3), transcript variant 1, 20 µg |
CNY 2900.00 |