CHST12 (NM_018641) Human Mass Spec Standard
CAT#: PH302514
CHST12 MS Standard C13 and N15-labeled recombinant protein (NP_061111)
View other "CHST12" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CHST12 MS Standard C13 and N15-labeled recombinant protein (NP_061111) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202514 |
| Predicted MW | 48.4 kDa |
| Protein Sequence |
>RC202514 protein sequence
Red=Cloning site Green=Tags(s) MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFL DKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFP TKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNA SAHLTFNKFWRRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYAN HTSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAA QLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061111 |
| RefSeq Size | 2159 |
| RefSeq ORF | 1242 |
| Synonyms | C4S-2; C4ST-2; C4ST2 |
| Locus ID | 55501 |
| Cytogenetics | 7p22.3 |
| Summary | The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin and desulfated dermatan sulfate. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage, and is distributed on the surfaces of many cells and extracellular matrices. Alternatively spliced transcript variants differing only in their 5' UTRs have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Families | Transmembrane |
| Protein Pathways | Chondroitin sulfate biosynthesis, Sulfur metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412989 | CHST12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412989 | Transient overexpression lysate of carbohydrate (chondroitin 4) sulfotransferase 12 (CHST12) |
CNY 3080.00 |
|
| TP302514 | Recombinant protein of human carbohydrate (chondroitin 4) sulfotransferase 12 (CHST12), 20 µg |
CNY 2900.00 |
