Apolipoprotein L 2 (APOL2) (NM_030882) Human Mass Spec Standard
CAT#: PH302585
APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092)
View other "Apolipoprotein L 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_112092) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202585 |
Predicted MW | 37.1 kDa |
Protein Sequence |
>RC202585 protein sequence
Red=Cloning site Green=Tags(s) MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHVIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112092 |
RefSeq Size | 2545 |
RefSeq ORF | 1011 |
Synonyms | APOL-II; APOL3 |
Locus ID | 23780 |
Cytogenetics | 22q12.3 |
Summary | This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403087 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407937 | APOL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403087 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant alpha |
CNY 3080.00 |
|
LY407937 | Transient overexpression lysate of apolipoprotein L, 2 (APOL2), transcript variant beta |
CNY 3080.00 |
|
PH316858 | APOL2 MS Standard C13 and N15-labeled recombinant protein (NP_663612) |
CNY 19520.00 |
|
TP302585 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant alpha, 20 µg |
CNY 2900.00 |
|
TP316858 | Recombinant protein of human apolipoprotein L, 2 (APOL2), transcript variant beta, 20 µg |
CNY 2900.00 |
其它Apolipoprotein L 2产品