C16orf57 (USB1) (NM_024598) Human Mass Spec Standard
CAT#: PH302591
C16orf57 MS Standard C13 and N15-labeled recombinant protein (NP_078874)
View other "C16orf57" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | C16orf57 MS Standard C13 and N15-labeled recombinant protein (NP_078874) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202591 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC202591 protein sequence
Red=Cloning site Green=Tags(s) MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGR VRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQA LKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLS LAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_078874 |
| RefSeq Size | 2287 |
| RefSeq ORF | 795 |
| Synonyms | C16orf57; hUsb1; HVSL1; Mpn1; PN |
| Locus ID | 79650 |
| Cytogenetics | 16q21 |
| Summary | This gene encodes a protein with several conserved domains, however, its exact function is not known. Mutations in this gene are associated with poikiloderma with neutropenia (PN), which shows phenotypic overlap with Rothmund-Thomson syndrome (RTS) caused by mutations in the RECQL4 gene. It is believed that this gene product interacts with RECQL4 protein via SMAD4 proteins, explaining the partial clinical overlap between PN and RTS. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Mar 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411214 | USB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434095 | USB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411214 | Transient overexpression lysate of chromosome 16 open reading frame 57 (C16orf57) |
CNY 3080.00 |
|
| LY434095 | Transient overexpression lysate of chromosome 16 open reading frame 57 (C16orf57), transcript variant 2 |
CNY 3080.00 |
|
| TP302591 | Recombinant protein of human chromosome 16 open reading frame 57 (C16orf57), 20 µg |
CNY 2900.00 |
其它C16orf57产品
