FBXO27 (NM_178820) Human Mass Spec Standard
CAT#: PH302615
FBXO27 MS Standard C13 and N15-labeled recombinant protein (NP_849142)
View other "FBXO27" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FBXO27 MS Standard C13 and N15-labeled recombinant protein (NP_849142) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202615 |
| Predicted MW | 31.4 kDa |
| Protein Sequence |
>RC202615 representing NM_178820
Red=Cloning site Green=Tags(s) MGASVSRGRAARVPAPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWRALVDGQALWLLI LARDHGATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDGWVVEE NRTTVPGAPSQTCFVTSFSWCCKKQVLDLEEEGLWPELLDSGRIEICVSDWWGARHDSGCMYRLLVQLLD ANQTVLDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGHYGARVTNSSVIVRV RLS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_849142 |
| RefSeq Size | 2338 |
| RefSeq ORF | 849 |
| Synonyms | FBG5; Fbx27 |
| Locus ID | 126433 |
| Cytogenetics | 19q13.2 |
| Summary | Members of the F-box protein family, such as FBXO27, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405838 | FBXO27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405838 | Transient overexpression lysate of F-box protein 27 (FBXO27) |
CNY 3080.00 |
|
| TP302615 | Recombinant protein of human F-box protein 27 (FBXO27), 20 µg |
CNY 2900.00 |
