RPS27L (NM_015920) Human Mass Spec Standard
CAT#: PH302658
RPS27L MS Standard C13 and N15-labeled recombinant protein (NP_057004)
View other "RPS27L" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RPS27L MS Standard C13 and N15-labeled recombinant protein (NP_057004) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202658 |
| Predicted MW | 9.5 kDa |
| Protein Sequence |
>RC202658 protein sequence
Red=Cloning site Green=Tags(s) MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK ARLTEGCSFRRKQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057004 |
| RefSeq Size | 1084 |
| RefSeq ORF | 252 |
| Locus ID | 51065 |
| Cytogenetics | 15q22.2 |
| Summary | This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Ribosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414323 | RPS27L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414323 | Transient overexpression lysate of ribosomal protein S27-like (RPS27L) |
CNY 3080.00 |
|
| TP302658 | Recombinant protein of human ribosomal protein S27-like (RPS27L), 20 µg |
CNY 2900.00 |
