MED4 (NM_014166) Human Mass Spec Standard
CAT#: PH302663
MED4 MS Standard C13 and N15-labeled recombinant protein (NP_054885)
View other "MED4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MED4 MS Standard C13 and N15-labeled recombinant protein (NP_054885) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202663 |
| Predicted MW | 29.7 kDa |
| Protein Sequence |
>RC202663 protein sequence
Red=Cloning site Green=Tags(s) MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054885 |
| RefSeq Size | 2287 |
| RefSeq ORF | 810 |
| Synonyms | ARC36; DRIP36; HSPC126; TRAP36; VDRIP |
| Locus ID | 29079 |
| Cytogenetics | 13q14.2 |
| Summary | This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415456 | MED4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415456 | Transient overexpression lysate of mediator complex subunit 4 (MED4) |
CNY 3080.00 |
|
| TP302663 | Recombinant protein of human mediator complex subunit 4 (MED4), 20 µg |
CNY 2900.00 |
