Kallikrein 2 (KLK2) (NM_005551) Human Mass Spec Standard
CAT#: PH302667
KLK2 MS Standard C13 and N15-labeled recombinant protein (NP_005542)
View other "Kallikrein 2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | KLK2 MS Standard C13 and N15-labeled recombinant protein (NP_005542) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202667 |
| Predicted MW | 28.7 kDa |
| Protein Sequence |
>RC202667 protein sequence
Red=Cloning site Green=Tags(s) MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKN SQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLG LPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCG GDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005542 |
| RefSeq Size | 2855 |
| RefSeq ORF | 783 |
| Synonyms | hGK-1; hK2; KLK2A2 |
| Locus ID | 3817 |
| Cytogenetics | 19q13.33 |
| Summary | This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded by this gene is a highly active trypsin-like serine protease that selectively cleaves at arginine residues. This protein is primarily expressed in prostatic tissue and is responsible for cleaving pro-prostate-specific antigen into its enzymatically active form. This gene is highly expressed in prostate tumor cells and may be a prognostic maker for prostate cancer risk. Alternate splicing results in both coding and non-coding transcript variants. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome, Protease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417229 | KLK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417229 | Transient overexpression lysate of kallikrein-related peptidase 2 (KLK2), transcript variant 1 |
CNY 3080.00 |
|
| TP302667 | Recombinant protein of human kallikrein-related peptidase 2 (KLK2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Kallikrein 2产品
