UQCRB (NM_006294) Human Mass Spec Standard
CAT#: PH302685
UQCRB MS Standard C13 and N15-labeled recombinant protein (NP_006285)
View other "UQCRB" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | UQCRB MS Standard C13 and N15-labeled recombinant protein (NP_006285) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202685 |
Predicted MW | 13.5 kDa |
Protein Sequence |
>RC202685 protein sequence
Red=Cloning site Green=Tags(s) MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLN LKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006285 |
RefSeq Size | 4839 |
RefSeq ORF | 333 |
Synonyms | MC3DN3; QCR7; QP-C; QPC; UQBC; UQBP; UQCR6; UQPC |
Locus ID | 7381 |
Cytogenetics | 8q22.1 |
Summary | This gene encodes a subunit of the ubiquinol-cytochrome c oxidoreductase complex, which consists of one mitochondrial-encoded and 10 nuclear-encoded subunits. The protein encoded by this gene binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. This protein plays an important role in hypoxia-induced angiogenesis through mitochondrial reactive oxygen species-mediated signaling. Mutations in this gene are associated with mitochondrial complex III deficiency. Alternatively spliced transcript variants have been found for this gene. Related pseudogenes have been identified on chromosomes 1, 5 and X. [provided by RefSeq, Dec 2011] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416737 | UQCRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416737 | Transient overexpression lysate of ubiquinol-cytochrome c reductase binding protein (UQCRB), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP302685 | Recombinant protein of human ubiquinol-cytochrome c reductase binding protein (UQCRB), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |