C1D (NM_006333) Human Mass Spec Standard
CAT＃: PH302688
C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202688 |
| Predicted MW | 16 kDa |
| Protein Sequence |
>RC202688 protein sequence
Red=Cloning site Green=Tags(s) MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK S myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006324 |
| RefSeq Size | 1207 |
| RefSeq ORF | 423 |
| Synonyms | hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR |
| Locus ID | 10438 |
| Cytogenetics | 2p14 |
| Summary | The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.[provided by RefSeq, Jun 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406634 | C1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416720 | C1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406634 | Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 2 |
CNY 3080.00 |
|
| LY416720 | Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 1 |
CNY 3080.00 |
|
| PH303301 | C1D MS Standard C13 and N15-labeled recombinant protein (NP_775269) |
CNY 19520.00 |
|
| TP302688 | Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP303301 | Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 2, 20 µg |
CNY 2900.00 |
