Creatine kinase M type (CKM) (NM_001824) Human Mass Spec Standard
CAT#: PH302721
CKM MS Standard C13 and N15-labeled recombinant protein (NP_001815)
View other "Creatine kinase M type" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CKM MS Standard C13 and N15-labeled recombinant protein (NP_001815) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202721 |
| Predicted MW | 43.1 kDa |
| Protein Sequence |
>RC202721 protein sequence
Red=Cloning site Green=Tags(s) MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIM TVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGY TLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARD WPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYV LTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQV QLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001815 |
| RefSeq Size | 1666 |
| RefSeq ORF | 1143 |
| Synonyms | CKMM; CPK-M; M-CK |
| Locus ID | 1158 |
| Cytogenetics | 19q13.32 |
| Summary | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400690 | CKM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400690 | Transient overexpression lysate of creatine kinase, muscle (CKM) |
CNY 3080.00 |
|
| TP302721 | Recombinant protein of human creatine kinase, muscle (CKM), 20 µg |
CNY 2900.00 |
|
| TP721121 | Purified recombinant protein of Human creatine kinase, muscle (CKM) |
CNY 1800.00 |
|
| TP750145 | Purified recombinant heterodimer protein of Human CKMB(full length creatine kinase, muscle (CKM) with N-terminal GST tag, and full length creatine kinase, brain (CKB), with N-terminal His(CKB) tag), expressed in E.coli, 100ug |
CNY 2841.00 |
其它Creatine kinase M type产品
