CDK7 (NM_001799) Human Mass Spec Standard
CAT#: PH302736
CDK7 MS Standard C13 and N15-labeled recombinant protein (NP_001790)
View other "CDK7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CDK7 MS Standard C13 and N15-labeled recombinant protein (NP_001790) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202736 |
| Predicted MW | 39.1 kDa |
| Protein Sequence |
>RC202736 protein sequence
Red=Cloning site Green=Tags(s) MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKP NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001790 |
| RefSeq Size | 1534 |
| RefSeq ORF | 1038 |
| Synonyms | CAK; CAK1; CDKN7; HCAK; MO15; p39MO15; STK1 |
| Locus ID | 1022 |
| Cytogenetics | 5q13.2 |
| Summary | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors |
| Protein Pathways | Cell cycle, Nucleotide excision repair |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419742 | CDK7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419742 | Transient overexpression lysate of cyclin-dependent kinase 7 (CDK7) |
CNY 3080.00 |
|
| TP302736 | Recombinant protein of human cyclin-dependent kinase 7 (CDK7), 20 µg |
CNY 2900.00 |

