Prostate Specific Antigen (KLK3) (NM_001648) Human Mass Spec Standard
CAT#: PH302740
KLK3 MS Standard C13 and N15-labeled recombinant protein (NP_001639)
View other "Prostate Specific Antigen" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | KLK3 MS Standard C13 and N15-labeled recombinant protein (NP_001639) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202740 |
| Predicted MW | 28.7 kDa |
| Protein Sequence |
>RC202740 protein sequence
Red=Cloning site Green=Tags(s) MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNK SVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMD LPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCS GDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001639 |
| RefSeq Size | 1464 |
| RefSeq ORF | 783 |
| Synonyms | APS; hK3; KLK2A1; PSA |
| Locus ID | 354 |
| Cytogenetics | 19q13.33 |
| Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease which is synthesized in the epithelial cells of the prostate gland, and is present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. The serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Dec 2019] |
| Protein Families | Druggable Genome, Protease, Secreted Protein |
| Protein Pathways | Pathways in cancer, Prostate cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419823 | KLK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419823 | Transient overexpression lysate of kallikrein-related peptidase 3 (KLK3), transcript variant 1 |
CNY 3080.00 |
|
| TP302740 | Recombinant protein of human kallikrein-related peptidase 3 (KLK3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720314 | Recombinant protein of human kallikrein-related peptidase 3 (KLK3), transcript variant 3 |
CNY 1800.00 |
其它Prostate Specific Antigen产品
