NFYB (NM_006166) Human Mass Spec Standard
CAT#: PH302749
NFYB MS Standard C13 and N15-labeled recombinant protein (NP_006157)
View other "NFYB" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NFYB MS Standard C13 and N15-labeled recombinant protein (NP_006157) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202749 |
| Predicted MW | 22.8 kDa |
| Protein Sequence |
>RC202749 protein sequence
Red=Cloning site Green=Tags(s) MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN AIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISGVQQIQFS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006157 |
| RefSeq Size | 3482 |
| RefSeq ORF | 621 |
| Synonyms | CBF-A; CBF-B; HAP3; NF-YB |
| Locus ID | 4801 |
| Cytogenetics | 12q23.3 |
| Summary | The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoter regions in a variety of genes. This gene product, subunit B, forms a tight dimer with the C subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Observation of the histone nature of these subunits is supported by two types of evidence; protein sequence alignments and experiments with mutants. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Antigen processing and presentation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401857 | NFYB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401857 | Transient overexpression lysate of nuclear transcription factor Y, beta (NFYB) |
CNY 3080.00 |
|
| TP302749 | Recombinant protein of human nuclear transcription factor Y, beta (NFYB), 20 µg |
CNY 2900.00 |

