Troponin C (TNNC2) (NM_003279) Human Mass Spec Standard
CAT#: PH302754
TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270)
View other "Troponin C" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TNNC2 MS Standard C13 and N15-labeled recombinant protein (NP_003270) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202754 |
| Predicted MW | 18.1 kDa |
| Protein Sequence |
>RC202754 protein sequence
Red=Cloning site Green=Tags(s) MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGD KNNDGRIDFDEFLKMMEGVQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003270 |
| RefSeq Size | 698 |
| RefSeq ORF | 480 |
| Synonyms | CFAP85; FAP85 |
| Locus ID | 7125 |
| Cytogenetics | 20q13.12 |
| Summary | Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Calcium signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401130 | TNNC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401130 | Transient overexpression lysate of troponin C type 2 (fast) (TNNC2) |
CNY 3080.00 |
|
| TP302754 | Recombinant protein of human troponin C type 2 (fast) (TNNC2), 20 µg |
CNY 2900.00 |
|
| TP710219 | Purified recombinant protein of Human troponin C type 2 (fast) (TNNC2), full length, with C-terminal DDK tag, expressed in sf9 insect cells |
CNY 4020.00 |
其它Troponin C产品
