Lumican (LUM) (NM_002345) Human Mass Spec Standard
CAT#: PH302757
LUM MS Standard C13 and N15-labeled recombinant protein (NP_002336)
View other "Lumican" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LUM MS Standard C13 and N15-labeled recombinant protein (NP_002336) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202757 |
| Predicted MW | 38.4 kDa |
| Protein Sequence |
>RC202757 protein sequence
Red=Cloning site Green=Tags(s) MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKY LYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLE DLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTL YLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYY LEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002336 |
| RefSeq Size | 2116 |
| RefSeq ORF | 1014 |
| Synonyms | LDC; SLRR2D |
| Locus ID | 4060 |
| Cytogenetics | 12q21.33 |
| Summary | This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419389 | LUM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419389 | Transient overexpression lysate of lumican (LUM) |
CNY 3080.00 |
|
| TP302757 | Recombinant protein of human lumican (LUM), 20 µg |
CNY 2900.00 |
|
| TP720321 | Recombinant protein of human lumican (LUM) |
CNY 1800.00 |
其它Lumican产品
