Fibrinogen gamma chain (FGG) (NM_000509) Human Mass Spec Standard
CAT#: PH302770
FGG MS Standard C13 and N15-labeled recombinant protein (NP_000500)
View other "Fibrinogen gamma chain" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FGG MS Standard C13 and N15-labeled recombinant protein (NP_000500) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202770 |
| Predicted MW | 49.5 kDa |
| Protein Sequence |
>RC202770 protein sequence
Red=Cloning site Green=Tags(s) MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLE DILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIY NSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEI DGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWN GRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG NCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI GEGQQHHLGGAKQAGDV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000500 |
| RefSeq Size | 1665 |
| RefSeq ORF | 1311 |
| Locus ID | 2266 |
| Cytogenetics | 4q32.1 |
| Summary | The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Complement and coagulation cascades |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400173 | FGG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400173 | Transient overexpression lysate of fibrinogen gamma chain (FGG), transcript variant gamma-A |
CNY 3080.00 |
|
| TP302770 | Recombinant protein of human fibrinogen gamma chain (FGG), transcript variant gamma-A, 20 µg |
CNY 2900.00 |
其它Fibrinogen gamma chain产品
