CTRB1 (NM_001906) Human Mass Spec Standard
CAT#: PH302806
CTRB1 MS Standard C13 and N15-labeled recombinant protein (NP_001897)
View other "CTRB1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CTRB1 MS Standard C13 and N15-labeled recombinant protein (NP_001897) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202806 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC202806 protein sequence
Red=Cloning site Green=Tags(s) MAFLWLLSCWALLGTTFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWV VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVC LPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASGVSSCM GDSGGPLVCQKDGAWTLVGIVSWGSDTCSTSSPGVYARVTKLIPWVQKILAAN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001897 |
RefSeq Size | 873 |
RefSeq ORF | 789 |
Synonyms | CTRB |
Locus ID | 1504 |
Cytogenetics | 16q23.1 |
Summary | This gene encodes a member of the serine protease family of enzymes and forms a principal precursor of the pancreatic proteolytic enzymes. The encoded preproprotein is synthesized in the acinar cells of the pancreas and secreted into the small intestine where it undergoes proteolytic activation to generate a functional enzyme. This CTRB1 gene is located head-to-head with the related CTRB2 gene. Some human populations have an alternate haplotype which inverts a 16.6 Kb region containing portions of intron 1, exon 1, and the upstream sequence of the CTRB1 and CTRB2 genes. In this inversion haplotype exon 1 and flanking sequence is swapped in CTRB1 and CTRB2. This inversion is associated with differential gene expression and increased risk for chronic pancreatitis. The GRCh38 assembly represents the minor allele for SNP rs8048956 of the CTRB1 gene. SNP rs8048956 in intron 1 of the CTRB2 gene is diagnostic for this inversion. This CTRB1 gene encodes distinct isoforms, some or all of which may undergo similar processing to generate the mature protein. [provided by RefSeq, Jan 2021] |
Protein Families | Druggable Genome, Protease, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419664 | CTRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419664 | Transient overexpression lysate of chymotrypsinogen B1 (CTRB1) |
CNY 3080.00 |
|
TP302806 | Recombinant protein of human chymotrypsinogen B1 (CTRB1), 20 µg |
CNY 2900.00 |
|
TP720408 | Recombinant Human Chymotrypsingen B/CTRB |
CNY 1800.00 |