RAB14 (NM_016322) Human Mass Spec Standard
CAT#: PH302832
RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406)
View other "RAB14" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202832 |
| Predicted MW | 23.9 kDa |
| Protein Sequence |
>RC202832 protein sequence
Red=Cloning site Green=Tags(s) MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR EGCGC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057406 |
| RefSeq Size | 4379 |
| RefSeq ORF | 645 |
| Synonyms | FBP; RAB-14 |
| Locus ID | 51552 |
| Cytogenetics | 9q33.2 |
| Summary | RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414055 | RAB14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414055 | Transient overexpression lysate of RAB14, member RAS oncogene family (RAB14) |
CNY 3080.00 |
|
| TP302832 | Recombinant protein of human RAB14, member RAS oncogene family (RAB14), 20 µg |
CNY 2900.00 |
