SIRT6 (NM_016539) Human Mass Spec Standard
CAT#: PH302833
SIRT6 MS Standard C13 and N15-labeled recombinant protein (NP_057623)
View other "SIRT6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SIRT6 MS Standard C13 and N15-labeled recombinant protein (NP_057623) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202833 |
| Predicted MW | 39.1 kDa |
| Protein Sequence |
>RC202833 protein sequence
Red=Cloning site Green=Tags(s) MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGV WTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEE CAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRNADLS ITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPR VLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKA KAVPS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057623 |
| RefSeq Size | 1657 |
| RefSeq ORF | 1065 |
| Synonyms | SIR2L6 |
| Locus ID | 51548 |
| Cytogenetics | 19p13.3 |
| Summary | This gene encodes a member of the sirtuin family of NAD-dependent enzymes that are implicated in cellular stress resistance, genomic stability, aging and energy homeostasis. The encoded protein is localized to the nucleus, exhibits ADP-ribosyl transferase and histone deacetylase activities, and plays a role in DNA repair, maintenance of telomeric chromatin, inflammation, lipid and glucose metabolism. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402563 | SIRT6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402563 | Transient overexpression lysate of sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) (SIRT6) |
CNY 3080.00 |
|
| TP302833 | Recombinant protein of human sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) (SIRT6), 20 µg |
CNY 2900.00 |
