PARP16 (NM_017851) Human Mass Spec Standard
CAT#: PH302846
PARP16 MS Standard C13 and N15-labeled recombinant protein (NP_060321)
View other "PARP16" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PARP16 MS Standard C13 and N15-labeled recombinant protein (NP_060321) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202846 |
| Predicted MW | 36.5 kDa |
| Protein Sequence |
>RC202846 protein sequence
Red=Cloning site Green=Tags(s) MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKE LLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYE TKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILS CVAVCEVIDHPDVKCQTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRA SSQLSWFSSHWFTVMISLYLLLLLIVSVINSSAFQHFWNRAKR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060321 |
| RefSeq Size | 2551 |
| RefSeq ORF | 969 |
| Synonyms | ARTD15; C15orf30; pART15 |
| Locus ID | 54956 |
| Cytogenetics | 15q22.31 |
| Summary | Intracellular mono-ADP-ribosyltransferase that may play a role in different processes through the mono-ADP-ribosylation of proteins involved in those processes (PubMed:23103912, PubMed:22701565, PubMed:25043379). May play a role in the unfolded protein response (UPR), by ADP-ribosylating and activating EIF2AK3 and ERN1, two important UPR effectors (PubMed:23103912). May also mediate mono-ADP-ribosylation of karyopherin KPNB1 a nuclear import factor (PubMed:22701565). May not modify proteins on arginine or cysteine residues compared to other mono-ADP-ribosyltransferases (PubMed:22701565).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402632 | PARP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402632 | Transient overexpression lysate of poly (ADP-ribose) polymerase family, member 16 (PARP16) |
CNY 3080.00 |
|
| TP302846 | Recombinant protein of human poly (ADP-ribose) polymerase family, member 16 (PARP16), 20 µg |
CNY 2900.00 |
