DDIT4 (NM_019058) Human Mass Spec Standard
CAT#: PH302847
DDIT4 MS Standard C13 and N15-labeled recombinant protein (NP_061931)
View other "DDIT4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DDIT4 MS Standard C13 and N15-labeled recombinant protein (NP_061931) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202847 |
Predicted MW | 25.4 kDa |
Protein Sequence |
>RC202847 protein sequence
Red=Cloning site Green=Tags(s) MPSLWDRFSSSSTSSSPSSLPRTPTPDRPPRSAWGSATREEGFDRSTSLESSDCESLDSSNSGFGPEEDT AYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPC GLRGALLDVCVEQGKSCHSVGQLALDPSLVPTFQLTLVLRLDSRLWPKIQGLFSSANSPFLPGFSQSLTL STGFRVIKKKLYSSEQLLIEEC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061931 |
RefSeq Size | 1752 |
RefSeq ORF | 696 |
Synonyms | Dig2; REDD-1; REDD1 |
Locus ID | 54541 |
Cytogenetics | 10q22.1 |
Summary | Regulates cell growth, proliferation and survival via inhibition of the activity of the mammalian target of rapamycin complex 1 (mTORC1). Inhibition of mTORC1 is mediated by a pathway that involves DDIT4/REDD1, AKT1, the TSC1-TSC2 complex and the GTPase RHEB. Plays an important role in responses to cellular energy levels and cellular stress, including responses to hypoxia and DNA damage. Regulates p53/TP53-mediated apoptosis in response to DNA damage via its effect on mTORC1 activity. Its role in the response to hypoxia depends on the cell type; it mediates mTORC1 inhibition in fibroblasts and thymocytes, but not in hepatocytes (By similarity). Required for mTORC1-mediated defense against viral protein synthesis and virus replication (By similarity). Inhibits neuronal differentiation and neurite outgrowth mediated by NGF via its effect on mTORC1 activity. Required for normal neuron migration during embryonic brain development. Plays a role in neuronal cell death.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | mTOR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402731 | DDIT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402731 | Transient overexpression lysate of DNA-damage-inducible transcript 4 (DDIT4) |
CNY 3080.00 |
|
TP302847 | Recombinant protein of human DNA-damage-inducible transcript 4 (DDIT4), 20 µg |
CNY 2900.00 |