TSSC4 (NM_005706) Human Mass Spec Standard
CAT#: PH302870
TSSC4 MS Standard C13 and N15-labeled recombinant protein (NP_005697)
View other "TSSC4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TSSC4 MS Standard C13 and N15-labeled recombinant protein (NP_005697) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202870 |
| Predicted MW | 34.3 kDa |
| Protein Sequence |
>RC202870 protein sequence
Red=Cloning site Green=Tags(s) MAEAGTGEPSPSVEGEHGTEYDTLPSDTVSLSDSDSDLSLPGGAEVEALSPMGLPGEEDSGPDEPPSPPS GLLPATVQPFHLRGMSSTFSQRSRDIFDCLEGAARRAPSSVAHTSMSDNGGFKRPLAPSGRSPVEGLGRA HRSPASPRVPPVPDYVAHPERWTKYSLEDVTEVSEQSNQATALAFLGSQSLAAPTDCVSSFNQDPSSCGE GRVIFTKPVRGVEARHERKRVLGKVGEPGRGGLGNPATDRGEGPVELAHLAGPGSPEAEEWGSPHGGLQE VEALSGSVHSGSVPGLPPVETVGFHGSRKRSRDHFRNKSSSPEDPGAEV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005697 |
| RefSeq Size | 1749 |
| RefSeq ORF | 987 |
| Locus ID | 10078 |
| Cytogenetics | 11p15.5 |
| Summary | This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is located among several imprinted genes; however, this gene, as well as the pan-hematopoietic expression gene (PHEMX), escapes imprinting. This gene may play a role in malignancies and disease that involve this region. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417124 | TSSC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417124 | Transient overexpression lysate of tumor suppressing subtransferable candidate 4 (TSSC4) |
CNY 3080.00 |
|
| TP302870 | Recombinant protein of human tumor suppressing subtransferable candidate 4 (TSSC4), 20 µg |
CNY 2900.00 |
