OPA3 (NM_025136) Human Mass Spec Standard
CAT#: PH302959
OPA3 MS Standard C13 and N15-labeled recombinant protein (NP_079412)
View other "OPA3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | OPA3 MS Standard C13 and N15-labeled recombinant protein (NP_079412) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202959 |
| Predicted MW | 20 kDa |
| Protein Sequence |
>RC202959 protein sequence
Red=Cloning site Green=Tags(s) MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKP LNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQV QAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_079412 |
| RefSeq Size | 7889 |
| RefSeq ORF | 537 |
| Synonyms | MGA3 |
| Locus ID | 80207 |
| Cytogenetics | 19q13.32 |
| Summary | The mouse ortholog of this protein co-purifies with the mitochondrial inner membrane. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410876 | OPA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410876 | Transient overexpression lysate of optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| TP302959 | Recombinant protein of human optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) (OPA3), transcript variant 2, 20 µg |
CNY 2900.00 |
