UFD1 (NM_005659) Human Mass Spec Standard
CAT#: PH302989
UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_005650)
View other "UFD1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_005650) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202989 |
| Predicted MW | 34.5 kDa |
| Protein Sequence |
>RC202989 protein sequence
Red=Cloning site Green=Tags(s) MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLT NKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKA VLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERQVQHEEST EGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKK VEEDEAGGRFVAFSGEGQSLRKKGRKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005650 |
| RefSeq Size | 1783 |
| RefSeq ORF | 921 |
| Synonyms | UFD1L |
| Locus ID | 7353 |
| Cytogenetics | 22q11.21 |
| Summary | The protein encoded by this gene forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18. [provided by RefSeq, Jun 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417150 | UFD1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422127 | UFD1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417150 | Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1 |
CNY 3080.00 |
|
| LY422127 | Transient overexpression lysate of ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 2 |
CNY 3080.00 |
|
| PH313180 | UFD1L MS Standard C13 and N15-labeled recombinant protein (NP_001030324) |
CNY 19520.00 |
|
| TP302989 | Recombinant protein of human ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313180 | Recombinant protein of human ubiquitin fusion degradation 1 like (yeast) (UFD1L), transcript variant 2, 20 µg |
CNY 2900.00 |
