HYI (NM_031207) Human Mass Spec Standard
CAT#: PH302991
HYI MS Standard C13 and N15-labeled recombinant protein (NP_112484)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HYI MS Standard C13 and N15-labeled recombinant protein (NP_112484) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC202991 |
| Predicted MW | 24.1 kDa |
| Protein Sequence |
>RC202991 protein sequence
Red=Cloning site Green=Tags(s) MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQE DLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQV AQVPGRGEPSSPGELNFPYLFQLLENEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRATQRLASEGPHTT HVPPDSE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112484 |
| RefSeq Size | 1251 |
| RefSeq ORF | 651 |
| Synonyms | HT036 |
| Locus ID | 81888 |
| Cytogenetics | 1p34.2 |
| Summary | This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
| Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410587 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434117 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410587 | Transient overexpression lysate of hydroxypyruvate isomerase homolog (E. coli) (HYI) |
CNY 3080.00 |
|
| LY434117 | Transient overexpression lysate of hydroxypyruvate isomerase (putative) (HYI), transcript variant 3 |
CNY 3080.00 |
|
| TP302991 | Recombinant protein of human hydroxypyruvate isomerase homolog (E. coli) (HYI), 20 µg |
CNY 2900.00 |
|
| TP331118 | Recombinant protein of human hydroxypyruvate isomerase (putative) (HYI), transcript variant 3, 20 µg |
CNY 2900.00 |
