MAP6D1 (NM_024871) Human Mass Spec Standard
CAT#: PH302993
MAP6D1 MS Standard C13 and N15-labeled recombinant protein (NP_079147)
View other "MAP6D1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | MAP6D1 MS Standard C13 and N15-labeled recombinant protein (NP_079147) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202993 |
Predicted MW | 20.8 kDa |
Protein Sequence |
>RC202993 representing NM_024871
Red=Cloning site Green=Tags(s) MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYSDLDSEEPGTGGAASRRGQPPAGARDSGRDVPLTQYQ RDFGLWTTPAGPKDPPPGRGPGAGGRRGKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAW TGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAPRILNV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_079147 |
RefSeq Size | 2104 |
RefSeq ORF | 597 |
Synonyms | MAPO6D1; SL21 |
Locus ID | 79929 |
Cytogenetics | 3q27.1 |
Summary | This gene encodes a protein highly similar to the mouse MAP6 domain containing 1 protein, which is related to the STOP proteins. Based on the study of the mouse protein, the encoded protein may function as a calmodulin-regulated neuronal protein that binds and stabilizes microtubules but also associates with the Golgi membranes through N-terminal palmitoylation. [provided by RefSeq, Oct 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411035 | MAP6D1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411035 | Transient overexpression lysate of MAP6 domain containing 1 (MAP6D1) |
CNY 3080.00 |
|
TP302993 | Purified recombinant protein of Homo sapiens MAP6 domain containing 1 (MAP6D1), 20 µg |
CNY 2900.00 |