ZNF397 (NM_032347) Human Mass Spec Standard
CAT#: PH303025
ZNF397 MS Standard C13 and N15-labeled recombinant protein (NP_115723)
View other "ZNF397" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | ZNF397 MS Standard C13 and N15-labeled recombinant protein (NP_115723) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203025 |
Predicted MW | 31.1 kDa |
Protein Sequence |
>RC203025 protein sequence
Red=Cloning site Green=Tags(s) MAVESGVISTLIPQDPPEQELILVKVEDNFSWDEKFKQNGSTQSCQELFRQQFRKFCYQETPGPREALSR LQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHNPESGEEAVTLLEDLEREFDDPGQQVP ASPQGPAVPWKDLTCLRASQESTDIHLQPLKTQLKSWKPCLSPKSDCENSETATKEGISEEKSQGLPQEP SFRGIKLSRPPKASSAIRWECVSPGSFPGDIIAAEATHSTISCFAINTLPATILPSKNVNRKYFS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115723 |
RefSeq Size | 1494 |
RefSeq ORF | 825 |
Synonyms | ZNF47; ZSCAN15 |
Locus ID | 84307 |
Cytogenetics | 18q12.2 |
Summary | This gene encodes a protein with a N-terminal SCAN domain, and the longer isoform contains nine C2H2-type zinc finger repeats in the C-terminal domain. The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found for this gene. Additional variants have been described, but their biological validity has not been determined. [provided by RefSeq, Oct 2009] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410184 | ZNF397 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427576 | ZNF397 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410184 | Transient overexpression lysate of zinc finger protein 397 (ZNF397), transcript variant 2 |
CNY 3080.00 |
|
LY427576 | Transient overexpression lysate of zinc finger protein 397 (ZNF397), transcript variant 1 |
CNY 3080.00 |
|
TP303025 | Recombinant protein of human zinc finger protein 397 (ZNF397), transcript variant 2, 20 µg |
CNY 2900.00 |