CCDC53 (WASHC3) (NM_016053) Human Mass Spec Standard
CAT#: PH303045
CCDC53 MS Standard C13 and N15-labeled recombinant protein (NP_057137)
View other "CCDC53" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CCDC53 MS Standard C13 and N15-labeled recombinant protein (NP_057137) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203045 |
Predicted MW | 21.1 kDa |
Protein Sequence |
>RC203045 protein sequence
Red=Cloning site Green=Tags(s) MDEDGLPLMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILD AKLSSIPGLDDVTVEVSPLNVTSVTNGAHPEATSEQPQQSSTQDSGLQESEVSAENILTVAKDPRYARYL KMVQVGVPVMAIRNKMISEGLDPDLLERPDAPVPDGESEKTVEESSDSESSFSD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057137 |
RefSeq Size | 1015 |
RefSeq ORF | 582 |
Synonyms | CCDC53; CGI-116 |
Locus ID | 51019 |
Cytogenetics | 12q23.2 |
Summary | Acts at least in part as component of the WASH core complex whose assembly at the surface of endosomes seems to inhibit WASH nucleation-promoting factor (NPF) activity in recruiting and activating the Arp2/3 complex to induce actin polymerization, and which is involved in regulation of the fission of tubules that serve as transport intermediates during endosome sorting (PubMed:19922875, PubMed:20498093).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414219 | CCDC53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414219 | Transient overexpression lysate of coiled-coil domain containing 53 (CCDC53) |
CNY 3080.00 |
|
TP303045 | Recombinant protein of human coiled-coil domain containing 53 (CCDC53), 20 µg |
CNY 2900.00 |