RNF2 (NM_007212) Human Mass Spec Standard
CAT#: PH303089
RNF2 MS Standard C13 and N15-labeled recombinant protein (NP_009143)
View other "RNF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RNF2 MS Standard C13 and N15-labeled recombinant protein (NP_009143) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203089 |
| Predicted MW | 37.7 kDa |
| Protein Sequence |
>RC203089 protein sequence
Red=Cloning site Green=Tags(s) MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHR FCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQAL SHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNN NAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQ MNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009143 |
| RefSeq Size | 3551 |
| RefSeq ORF | 1008 |
| Synonyms | BAP-1; BAP1; DING; HIPI3; RING1B; RING2 |
| Locus ID | 6045 |
| Cytogenetics | 1q25.3 |
| Summary | Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402109 | RNF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402109 | Transient overexpression lysate of ring finger protein 2 (RNF2) |
CNY 3080.00 |
|
| TP303089 | Recombinant protein of human ring finger protein 2 (RNF2), 20 µg |
CNY 2900.00 |
