ELK3 (NM_005230) Human Mass Spec Standard
CAT#: PH303114
ELK3 MS Standard C13 and N15-labeled recombinant protein (NP_005221)
View other "ELK3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ELK3 MS Standard C13 and N15-labeled recombinant protein (NP_005221) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203114 |
| Predicted MW | 44.2 kDa |
| Protein Sequence |
>RC203114 protein sequence
Red=Cloning site Green=Tags(s) MESAITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDKN IIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHS GLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVSLPSTSEAAAA SAFLASSVSAKISSLMLPNAASISSASPFSSRSPSLSPNSPLPSEHRSLFLEAACHDSDSLEPLNLSSGS KTKSPSLPPKAKKPKGLEISAPPLVLSGTDIGSIALNSPALPSGSLTPAFFTAQTPNGLLLTPSPLLSSI HFWSSLSPVAPLSPARLQGPSTLFQFPTLLNGHMPVPIPSLDRAASPVLLSSNSQKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005221 |
| RefSeq Size | 2180 |
| RefSeq ORF | 1221 |
| Synonyms | ERP; NET; SAP-2; SAP2 |
| Locus ID | 2004 |
| Cytogenetics | 12q23.1 |
| Summary | This gene encodes a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401602 | ELK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401602 | Transient overexpression lysate of ELK3, ETS-domain protein (SRF accessory protein 2) (ELK3) |
CNY 3080.00 |
|
| TP303114 | Recombinant protein of human ELK3, ETS-domain protein (SRF accessory protein 2) (ELK3), 20 µg |
CNY 2900.00 |
