PSMD7 (NM_002811) Human Mass Spec Standard
CAT#: PH303133
PSMD7 MS Standard C13 and N15-labeled recombinant protein (NP_002802)
View other "PSMD7" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSMD7 MS Standard C13 and N15-labeled recombinant protein (NP_002802) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203133 |
| Predicted MW | 37 kDa |
| Protein Sequence |
>RC203133 protein sequence
Red=Cloning site Green=Tags(s) MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFL DHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYIS VEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRS YLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKI ANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002802 |
| RefSeq Size | 1686 |
| RefSeq ORF | 972 |
| Synonyms | MOV34; P40; Rpn8; S12 |
| Locus ID | 5713 |
| Cytogenetics | 16q23.1 |
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 17. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Proteasome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419091 | PSMD7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419091 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (PSMD7) |
CNY 3080.00 |
|
| TP303133 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 (PSMD7), 20 µg |
CNY 2900.00 |
