PSG5 (NM_002781) Human Mass Spec Standard
CAT#: PH303134
PSG5 MS Standard C13 and N15-labeled recombinant protein (NP_002772)
View other "PSG5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PSG5 MS Standard C13 and N15-labeled recombinant protein (NP_002772) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203134 |
| Predicted MW | 37.7 kDa |
| Protein Sequence |
>RC203134 protein sequence
Red=Cloning site Green=Tags(s) MGPLSAPPCTQHITWKGVLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKQPIENRILILPSVTRN ETGPYECEIRDRDGGMHSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002772 |
| RefSeq Size | 1669 |
| RefSeq ORF | 1005 |
| Synonyms | FL-NCA-3; PSG |
| Locus ID | 5673 |
| Cytogenetics | 19q13.31 |
| Summary | The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419109 | PSG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427103 | PSG5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419109 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1 |
CNY 3080.00 |
|
| LY427103 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 2 |
CNY 3080.00 |
|
| TP303134 | Recombinant protein of human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP721096 | Purified recombinant protein of Human pregnancy specific beta-1-glycoprotein 5 (PSG5), transcript variant 1 |
CNY 1800.00 |
